Lineage for d1acz__ (1acz -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) 
Protein Glucoamilase, granular starch-binding domain [49460] (1 species) Species Aspergillus niger [49461] (4 PDB entries) 
Domain d1acz__: 1acz - [22524]
Details for d1acz__
PDB Entry: 1acz (more details)
PDB Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, 5 structures
SCOP Domain Sequences for d1acz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1acz__ b.3.1.1 (-) Glucoamilase, granular starch-binding domain {Aspergillus niger}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
SCOP Domain Coordinates for d1acz__:
Click to download the PDB-style file with coordinates for d1acz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1acz__:
- d1acz__ first appeared (with stable ids) in SCOP 1.55
- d1acz__ appears in SCOP 1.59
- d1acz__ appears in the current release, SCOPe 2.08, called d1acza_
View in 3D