Lineage for d1dedb2 (1ded B:583-686)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223936Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 223937Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 223938Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 223948Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 223980Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (4 PDB entries)
  8. 223988Domain d1dedb2: 1ded B:583-686 [22520]
    Other proteins in same PDB: d1deda1, d1deda3, d1deda4, d1dedb1, d1dedb3, d1dedb4
    complexed with acr, ca; mutant

Details for d1dedb2

PDB Entry: 1ded (more details), 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

SCOP Domain Sequences for d1dedb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dedb2 b.3.1.1 (B:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOP Domain Coordinates for d1dedb2:

Click to download the PDB-style file with coordinates for d1dedb2.
(The format of our PDB-style files is described here.)

Timeline for d1dedb2: