Class b: All beta proteins [48724] (119 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (4 PDB entries) |
Domain d1dedb2: 1ded B:583-686 [22520] Other proteins in same PDB: d1deda1, d1deda3, d1deda4, d1dedb1, d1dedb3, d1dedb4 complexed with acr, ca; mutant |
PDB Entry: 1ded (more details), 2 Å
SCOP Domain Sequences for d1dedb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dedb2 b.3.1.1 (B:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011} tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp
Timeline for d1dedb2:
View in 3D Domains from other chains: (mouse over for more information) d1deda1, d1deda2, d1deda3, d1deda4 |