Lineage for d1d7fa2 (1d7f A:583-686)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10541Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (3 PDB entries)
  8. 10544Domain d1d7fa2: 1d7f A:583-686 [22517]
    Other proteins in same PDB: d1d7fa1, d1d7fa3, d1d7fa4, d1d7fb1, d1d7fb3, d1d7fb4

Details for d1d7fa2

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution

SCOP Domain Sequences for d1d7fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fa2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOP Domain Coordinates for d1d7fa2:

Click to download the PDB-style file with coordinates for d1d7fa2.
(The format of our PDB-style files is described here.)

Timeline for d1d7fa2: