Lineage for d1d7fb4 (1d7f B:1-406)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18748Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 18749Species Alkalophilic bacillus sp., strain 1011 [51456] (3 PDB entries)
  8. 18753Domain d1d7fb4: 1d7f B:1-406 [28743]
    Other proteins in same PDB: d1d7fa1, d1d7fa2, d1d7fa3, d1d7fb1, d1d7fb2, d1d7fb3

Details for d1d7fb4

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution

SCOP Domain Sequences for d1d7fb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavknmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1d7fb4:

Click to download the PDB-style file with coordinates for d1d7fb4.
(The format of our PDB-style files is described here.)

Timeline for d1d7fb4: