Lineage for d6cgta2 (6cgt A:580-684)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768632Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2768633Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 2768673Domain d6cgta2: 6cgt A:580-684 [22506]
    Other proteins in same PDB: d6cgta1, d6cgta3, d6cgta4
    complexed with ca, opg; mutant

Details for d6cgta2

PDB Entry: 6cgt (more details), 2.6 Å

PDB Description: hoxa complex of cyclodextrin glycosyltransferase mutant
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d6cgta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cgta2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

SCOPe Domain Coordinates for d6cgta2:

Click to download the PDB-style file with coordinates for d6cgta2.
(The format of our PDB-style files is described here.)

Timeline for d6cgta2: