SCOP 1.71: Domain d2dij_2: 2dij 584-686

Lineage for d2dij_2 (2dij 584-686)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (2 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d2dij_2: 2dij 584-686 [22505]
   Other proteins in same PDB: d2dij_1, d2dij_3, d2dij_4
   complexed with aci, ca, glc, gld; mutant

Details for d2dij_2

PDB Entry: 2dij, 2.6 Å

PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose

SCOP Domain Sequences for d2dij_2:

Sequence; same for both SEQRES and ATOM records:

>d2dij_2 b.3.1.1 (584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d2dij_2:

• d2dij_2 first appeared (with stable ids) in SCOP 1.55
  
• d2dij_2 appears in SCOP 1.69
  
• d2dij_2 is called d2dija2 in SCOP 1.73
  
• d2dij_2 appears in the current release, SCOPe 2.08, called d2dija2