Lineage for d2dij_2 (2dij 584-686)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10511Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 10512Species Bacillus circulans, different strains [TaxId:1397] [49455] (27 PDB entries)
  8. 10531Domain d2dij_2: 2dij 584-686 [22505]
    Other proteins in same PDB: d2dij_1, d2dij_3, d2dij_4

Details for d2dij_2

PDB Entry: 2dij (more details), 2.6 Å

PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose

SCOP Domain Sequences for d2dij_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dij_2 b.3.1.1 (584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp
agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d2dij_2:

Click to download the PDB-style file with coordinates for d2dij_2.
(The format of our PDB-style files is described here.)

Timeline for d2dij_2: