Class b: All beta proteins [48724] (119 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries) |
Domain d1d3ca2: 1d3c A:584-686 [22496] Other proteins in same PDB: d1d3ca1, d1d3ca3, d1d3ca4 |
PDB Entry: 1d3c (more details), 1.78 Å
SCOP Domain Sequences for d1d3ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3ca2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains} gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1d3ca2: