SCOPe 2.07: Domain d4lnaa1: 4lna A:1-271

Lineage for d4lnaa1 (4lna A:1-271)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (45 species)
   not a true protein

7. Species Spirosoma linguale [TaxId:504472] [226736] (1 PDB entry)

8. Domain d4lnaa1: 4lna A:1-271 [224720]
   Other proteins in same PDB: d4lnaa2
   automated match to d2q7oe_
   complexed with ade, cl, mpd, po4

Details for d4lnaa1

PDB Entry: 4lna, 2.1 Å

PDB Description: crystal structure of purine nucleoside phosphorylase i from spirosoma linguale dsm 74, nysgrc target 029362

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4lnaa1:

Sequence, based on SEQRES records:

>d4lnaa1 c.56.2.0 (A:1-271) automated matches {Spirosoma linguale [TaxId: 504472]}
mfeqiqettqfiqskitlrpaigiilgtglgaltneldidttipyetiphfplstvefhs
gklligtlggksvvvmqgrfhyyegytmqqvtypvrvmhalgiqtllvsnaaggmnptfq
tsdlmviddhislllpqnplicpnppifgdrfpdmsepyrkslidlafsvaaeldiplkr
gvyvsvtgpqletraeyrmlrqwgadavgmstvpevivanqlgmdvfgisvitdlcfpdt
lekaelvkilataaqaepkltmliremigrl

Sequence, based on observed residues (ATOM records):

>d4lnaa1 c.56.2.0 (A:1-271) automated matches {Spirosoma linguale [TaxId: 504472]}
mfeqiqettqfiqskitlrpaigiilgtglgaltneldidttipyetiphfplstvsgkl
ligtlggksvvvmqgrfhyyegytmqqvtypvrvmhalgiqtllvsnaaggmnptfqtsd
lmviddhislllpqnplicpnppifgdrfpdmsepyrkslidlafsvaaeldiplkrgvy
vsvtgpqletraeyrmlrqwgadavgmstvpevivanqlgmdvfgisvitdlcfpdtlek
aelvkilataaqaepkltmliremigrl

Timeline for d4lnaa1:

• d4lnaa1 first appeared in SCOPe 2.03, called d4lnaa_
  
• d4lnaa1 appears in SCOPe 2.06
  
• d4lnaa1 appears in the current release, SCOPe 2.08