Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (45 species) not a true protein |
Species Spirosoma linguale [TaxId:504472] [226736] (1 PDB entry) |
Domain d4lnaa1: 4lna A:1-271 [224720] Other proteins in same PDB: d4lnaa2 automated match to d2q7oe_ complexed with ade, cl, mpd, po4 |
PDB Entry: 4lna (more details), 2.1 Å
SCOPe Domain Sequences for d4lnaa1:
Sequence, based on SEQRES records: (download)
>d4lnaa1 c.56.2.0 (A:1-271) automated matches {Spirosoma linguale [TaxId: 504472]} mfeqiqettqfiqskitlrpaigiilgtglgaltneldidttipyetiphfplstvefhs gklligtlggksvvvmqgrfhyyegytmqqvtypvrvmhalgiqtllvsnaaggmnptfq tsdlmviddhislllpqnplicpnppifgdrfpdmsepyrkslidlafsvaaeldiplkr gvyvsvtgpqletraeyrmlrqwgadavgmstvpevivanqlgmdvfgisvitdlcfpdt lekaelvkilataaqaepkltmliremigrl
>d4lnaa1 c.56.2.0 (A:1-271) automated matches {Spirosoma linguale [TaxId: 504472]} mfeqiqettqfiqskitlrpaigiilgtglgaltneldidttipyetiphfplstvsgkl ligtlggksvvvmqgrfhyyegytmqqvtypvrvmhalgiqtllvsnaaggmnptfqtsd lmviddhislllpqnplicpnppifgdrfpdmsepyrkslidlafsvaaeldiplkrgvy vsvtgpqletraeyrmlrqwgadavgmstvpevivanqlgmdvfgisvitdlcfpdtlek aelvkilataaqaepkltmliremigrl
Timeline for d4lnaa1: