SCOPe 2.04: Domain d4ln1c1: 4ln1 C:-6-147

Lineage for d4ln1c1 (4ln1 C:-6-147)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [189455] (3 PDB entries)

8. Domain d4ln1c1: 4ln1 C:-6-147 [224716]
   Other proteins in same PDB: d4ln1a2, d4ln1b2, d4ln1c2, d4ln1d2
   automated match to d1ldna1
   complexed with ca

Details for d4ln1c1

PDB Entry: 4ln1, 1.9 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579 complexed with calcium, nysgrc target 029452

PDB Compounds: (C:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d4ln1c1:

Sequence, based on SEQRES records:

>d4ln1c1 c.2.1.0 (C:-6-147) automated matches {Bacillus cereus [TaxId: 226900]}
enlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlsha
vpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsg
fdgifliatnpvdiltyvtwkesglpkervigsg

Sequence, based on observed residues (ATOM records):

>d4ln1c1 c.2.1.0 (C:-6-147) automated matches {Bacillus cereus [TaxId: 226900]}
enlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlsha
vpfapaptrvwkgsyedckdadlvvitaglptrldlveknakifkqivrsimdsgfdgif
liatnpvdiltyvtwkesglpkervigsg

Timeline for d4ln1c1:

• d4ln1c1 first appeared in SCOPe 2.03
  
• d4ln1c1 appears in SCOPe 2.05
  
• d4ln1c1 appears in the current release, SCOPe 2.08