Lineage for d4llsb_ (4lls B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504597Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1504598Protein automated matches [196409] (27 species)
    not a true protein
  7. 1504688Species Roseobacter denitrificans [TaxId:375451] [226733] (2 PDB entries)
  8. 1504690Domain d4llsb_: 4lls B: [224702]
    automated match to d3lvsa_
    complexed with ca, gst, ipe

Details for d4llsb_

PDB Entry: 4lls (more details), 1.5 Å

PDB Description: crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with ipp, gspp, and calcium bound in active site
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d4llsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llsb_ a.128.1.0 (B:) automated matches {Roseobacter denitrificans [TaxId: 375451]}
smftqrldaaaaavqahfdkvlaafeplpiveamahatsggkrlrgflvletarlhdiaa
geaiwsataiealhayslvhddlpcmdnddmrrgqptvhkkwddatavlagdalqtlafe
lvthpgasasaevradlalslarasgaqgmvlgqaldiaaetaraplsldeitrlqqgkt
galigwsaqagarlaqadtaalkryaqalglafqiaddildvtgdsaqvgkavgkdasag
katfvsllgldaararamslideacdslatygakadtlretarfvvrrth

SCOPe Domain Coordinates for d4llsb_:

Click to download the PDB-style file with coordinates for d4llsb_.
(The format of our PDB-style files is described here.)

Timeline for d4llsb_: