Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Xenorhabdus nematophila [TaxId:406817] [226705] (1 PDB entry) |
Domain d4l8ea1: 4l8e A:7-91 [224595] Other proteins in same PDB: d4l8ea2 automated match to d1k0db2 complexed with cl, gsh, mes |
PDB Entry: 4l8e (more details), 1.7 Å
SCOPe Domain Sequences for d4l8ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l8ea1 c.47.1.0 (A:7-91) automated matches {Xenorhabdus nematophila [TaxId: 406817]} idlyyaptpngykitlfleevglpytihpidisagdqfkpeflaiapnnkipaivdhqpd gggeaisifesgaillylanktgrf
Timeline for d4l8ea1: