Lineage for d4l8ea1 (4l8e A:7-91)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488460Species Xenorhabdus nematophila [TaxId:406817] [226705] (1 PDB entry)
  8. 2488461Domain d4l8ea1: 4l8e A:7-91 [224595]
    Other proteins in same PDB: d4l8ea2
    automated match to d1k0db2
    complexed with cl, gsh, mes

Details for d4l8ea1

PDB Entry: 4l8e (more details), 1.7 Å

PDB Description: Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4l8ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l8ea1 c.47.1.0 (A:7-91) automated matches {Xenorhabdus nematophila [TaxId: 406817]}
idlyyaptpngykitlfleevglpytihpidisagdqfkpeflaiapnnkipaivdhqpd
gggeaisifesgaillylanktgrf

SCOPe Domain Coordinates for d4l8ea1:

Click to download the PDB-style file with coordinates for d4l8ea1.
(The format of our PDB-style files is described here.)

Timeline for d4l8ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l8ea2