Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (213 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d4l7yc_: 4l7y C: [224588] Other proteins in same PDB: d4l7yb_, d4l7yd_ automated match to d1irda_ complexed with dg2, irl, mh0 |
PDB Entry: 4l7y (more details), 1.8 Å
SCOPe Domain Sequences for d4l7yc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l7yc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d4l7yc_: