Lineage for d4l6sb1 (4l6s B:662-796)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325389Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2325390Protein automated matches [226964] (2 species)
    not a true protein
  7. 2325394Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)
  8. 2325430Domain d4l6sb1: 4l6s B:662-796 [224571]
    Other proteins in same PDB: d4l6sa2, d4l6sa3, d4l6sb2, d4l6sb3
    automated match to d1gs0a1
    protein/DNA complex; complexed with 1wq

Details for d4l6sb1

PDB Entry: 4l6s (more details), 2.2 Å

PDB Description: parp complexed with benzo[1,4]oxazin-3-one inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4l6sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l6sb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d4l6sb1:

Click to download the PDB-style file with coordinates for d4l6sb1.
(The format of our PDB-style files is described here.)

Timeline for d4l6sb1: