Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (105 PDB entries) Uniprot P00183 |
Domain d4l4ca_: 4l4c A: [224557] automated match to d2a1na_ complexed with cam, hem, k; mutant |
PDB Entry: 4l4c (more details), 2.2 Å
SCOPe Domain Sequences for d4l4ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4ca_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlgyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlcpgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d4l4ca_: