Lineage for d1ikna2 (1ikn A:19-191)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223643Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 223784Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 223803Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 223818Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 223825Species Mouse (Mus musculus) [TaxId:10090] [49429] (4 PDB entries)
  8. 223826Domain d1ikna2: 1ikn A:19-191 [22449]
    Other proteins in same PDB: d1ikna1, d1iknc_, d1iknd_

Details for d1ikna2

PDB Entry: 1ikn (more details), 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex

SCOP Domain Sequences for d1ikna2:

Sequence, based on SEQRES records: (download)

>d1ikna2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

Sequence, based on observed residues (ATOM records): (download)

>d1ikna2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrat

SCOP Domain Coordinates for d1ikna2:

Click to download the PDB-style file with coordinates for d1ikna2.
(The format of our PDB-style files is described here.)

Timeline for d1ikna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ikna1