![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
![]() | Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
![]() | Protein p52 subunit of NF-kappa B (NFKB), N-terminal domain [49426] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49427] (1 PDB entry) |
![]() | Domain d1a3qb2: 1a3q B:37-226 [22448] Other proteins in same PDB: d1a3qa1, d1a3qb1 protein/DNA complex; mutant |
PDB Entry: 1a3q (more details), 2.1 Å
SCOP Domain Sequences for d1a3qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3qb2 b.2.5.3 (B:37-226) p52 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrslplkpvisqpihdsks pgas
Timeline for d1a3qb2: