PDB entry 1a3q

View 1a3q on RCSB PDB site
Description: human nf-kappa-b p52 bound to DNA
Class: transcription/DNA
Keywords: transcription factor, immune response, DNA-protein complex
Deposited on 1998-01-23, released 1998-05-27
The last revision prior to the SCOP 1.73 freeze date was dated 1998-06-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nuclear factor kappa-b p52)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00653 (0-284)
      • conflict (170)
    Domains in SCOP 1.73: d1a3qa1, d1a3qa2
  • Chain 'B':
    Compound: protein (nuclear factor kappa-b p52)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00653 (0-284)
      • conflict (170)
    Domains in SCOP 1.73: d1a3qb1, d1a3qb2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*gp*gp*gp*ap*ap*tp*cp*cp*cp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*gp*gp*gp*gp*ap*tp*tp*cp*cp*cp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3qA (A:)
    gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv
    thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr
    qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrslplkpvisqpihdsks
    pgasnlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvh
    kqyaivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a3qB (B:)
    gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv
    thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr
    qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrslplkpvisqpihdsks
    pgasnlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvh
    kqyaivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.