Lineage for d4kqxa2 (4kqx A:194-335)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2335037Species Slackia exigua [TaxId:649764] [226701] (2 PDB entries)
  8. 2335040Domain d4kqxa2: 4kqx A:194-335 [224451]
    Other proteins in same PDB: d4kqxa1, d4kqxb1, d4kqxb3
    automated match to d1np3a1
    complexed with hio, his, mg, nad; mutant

Details for d4kqxa2

PDB Entry: 4kqx (more details), 1.8 Å

PDB Description: Mutant Slackia exigua KARI DDV in complex with NAD and an inhibitor
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4kqxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kqxa2 a.100.1.0 (A:194-335) automated matches {Slackia exigua [TaxId: 649764]}
faeeteedlfgeqavlcgglvelvkagfetlteagyppelayfecyhemkmivdlmyesg
ihfmnysisntaeygeyyagpkvineqsreamkeilkriqdgsfaqefvddcnnghkrll
eqreainthpiettgaqirsmf

SCOPe Domain Coordinates for d4kqxa2:

Click to download the PDB-style file with coordinates for d4kqxa2.
(The format of our PDB-style files is described here.)

Timeline for d4kqxa2: