Lineage for d1nfka2 (1nfk A:39-250)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 105991Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 106094Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 106095Family b.2.5.1: p53-like transcription factors [49418] (11 proteins)
  6. 106117Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 106120Species Mouse (Mus musculus) [TaxId:10090] [49425] (2 PDB entries)
  8. 106121Domain d1nfka2: 1nfk A:39-250 [22444]
    Other proteins in same PDB: d1nfka1, d1nfkb1

Details for d1nfka2

PDB Entry: 1nfk (more details), 2.3 Å

PDB Description: structure of the nuclear factor kappa-b (nf-kb) p50 homodimer

SCOP Domain Sequences for d1nfka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfka2 b.2.5.1 (A:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

SCOP Domain Coordinates for d1nfka2:

Click to download the PDB-style file with coordinates for d1nfka2.
(The format of our PDB-style files is described here.)

Timeline for d1nfka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nfka1