Lineage for d1a66a_ (1a66 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.5: p53-like transcription factors [49417] (1 family) 
Family b.2.5.1: p53-like transcription factors [49418] (12 proteins) 
Protein Transcription factor NFATC, DNA-binding domain [49421] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49422] (3 PDB entries) 
Domain d1a66a_: 1a66 A: [22441]
Details for d1a66a_
PDB Entry: 1a66 (more details)
PDB Description: solution nmr structure of the core nfatc1/dna complex, 18 structures
SCOP Domain Sequences for d1a66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a66a_ b.2.5.1 (A:) Transcription factor NFATC, DNA-binding domain {Human (Homo sapiens)}
mkdwqlpshsgpyelrievqpkshhraryetegsrgavkasagghpivqlhgyleneplm
lqlfigtaddrllrphafyqvhritgktvsttsheailsntkvleipllpensmravidc
agilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtlslqvasnpiecsqrs
SCOP Domain Coordinates for d1a66a_:
Click to download the PDB-style file with coordinates for d1a66a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a66a_:
- d1a66a_ first appeared (with stable ids) in SCOP 1.55
- d1a66a_ appears in SCOP 1.59
- d1a66a_ appears in SCOP 1.63
- d1a66a_ appears in the current release, SCOPe 2.08
View in 3D