SCOPe 2.07: Domain d4kklc1: 4kkl C:2-121

Lineage for d4kklc1 (4kkl C:2-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (61 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d4kklc1: 4kkl C:2-121 [224336]
   Other proteins in same PDB: d4kkla_, d4kklb_, d4kklc2, d4kkld1, d4kkld2, d4kkle2, d4kklf1, d4kklf2
   automated match to d1otsc1
   complexed with f; mutant

Details for d4kklc1

PDB Entry: 4kkl, 2.85 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 delta NC construct in 100mM fluoride

PDB Compounds: (C:) Fab, heavy chain

SCOPe Domain Sequences for d4kklc1:

Sequence; same for both SEQRES and ATOM records:

>d4kklc1 b.1.1.1 (C:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

Timeline for d4kklc1:

• d4kklc1 first appeared in SCOPe 2.03
  
• d4kklc1 appears in SCOPe 2.06
  
• d4kklc1 appears in the current release, SCOPe 2.08