SCOPe 2.07: Domain d4kk8d1: 4kk8 D:1-106

Lineage for d4kk8d1 (4kk8 D:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (42 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d4kk8d1: 4kk8 D:1-106 [224328]
   Other proteins in same PDB: d4kk8a_, d4kk8b_, d4kk8c1, d4kk8c2, d4kk8d2, d4kk8e1, d4kk8e2, d4kk8f2
   automated match to d1otsd1
   complexed with f; mutant

Details for d4kk8d1

PDB Entry: 4kk8, 2.86 Å

PDB Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in 100mM fluoride

PDB Compounds: (D:) Fab, light chain

SCOPe Domain Sequences for d4kk8d1:

Sequence; same for both SEQRES and ATOM records:

>d4kk8d1 b.1.1.1 (D:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d4kk8d1:

• d4kk8d1 first appeared in SCOPe 2.03
  
• d4kk8d1 appears in SCOPe 2.06
  
• d4kk8d1 appears in the current release, SCOPe 2.08