Lineage for d4kdyb1 (4kdy B:1-85)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2486946Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries)
  8. 2486952Domain d4kdyb1: 4kdy B:1-85 [224258]
    Other proteins in same PDB: d4kdya2, d4kdya3, d4kdyb2, d4kdyb3
    automated match to d1e6ba2
    complexed with cit, gol, gsh

Details for d4kdyb1

PDB Entry: 4kdy (more details), 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
PDB Compounds: (B:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kdyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdyb1 c.47.1.0 (B:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvleve
edgrthllvqsmailewleerhpep

SCOPe Domain Coordinates for d4kdyb1:

Click to download the PDB-style file with coordinates for d4kdyb1.
(The format of our PDB-style files is described here.)

Timeline for d4kdyb1: