Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries) |
Domain d4kdyb1: 4kdy B:1-85 [224258] Other proteins in same PDB: d4kdya2, d4kdya3, d4kdyb2, d4kdyb3 automated match to d1e6ba2 complexed with cit, gol, gsh |
PDB Entry: 4kdy (more details), 1.5 Å
SCOPe Domain Sequences for d4kdyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdyb1 c.47.1.0 (B:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]} mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvleve edgrthllvqsmailewleerhpep
Timeline for d4kdyb1: