Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein) automatically mapped to Pfam PF03173 |
Protein Bacterial chitobiase, n-terminal domain [49399] (1 species) |
Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries) |
Domain d1c7ta2: 1c7t A:28-200 [22409] Other proteins in same PDB: d1c7ta1, d1c7ta3, d1c7ta4 complexed with so4; mutant |
PDB Entry: 1c7t (more details), 1.9 Å
SCOPe Domain Sequences for d1c7ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ta2 b.2.2.3 (A:28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens [TaxId: 615]} dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv
Timeline for d1c7ta2: