Lineage for d4jcrn_ (4jcr N:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462083Species Listeria monocytogenes [TaxId:169963] [226688] (2 PDB entries)
  8. 2462123Domain d4jcrn_: 4jcr N: [223742]
    automated match to d3q7hc_
    mutant

Details for d4jcrn_

PDB Entry: 4jcr (more details), 2.1 Å

PDB Description: ClpP1 N165D mutant from Listeria monocytogenes
PDB Compounds: (N:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4jcrn_:

Sequence, based on SEQRES records: (download)

>d4jcrn_ c.14.1.0 (N:) automated matches {Listeria monocytogenes [TaxId: 169963]}
iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvqgqsteieie
akeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk

Sequence, based on observed residues (ATOM records): (download)

>d4jcrn_ c.14.1.0 (N:) automated matches {Listeria monocytogenes [TaxId: 169963]}
iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk

SCOPe Domain Coordinates for d4jcrn_:

Click to download the PDB-style file with coordinates for d4jcrn_.
(The format of our PDB-style files is described here.)

Timeline for d4jcrn_: