Lineage for d4j6pa_ (4j6p A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682170Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)
  7. 1682171Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries)
    Uniprot P06734 156-298
  8. 1682176Domain d4j6pa_: 4j6p A: [223591]
    automated match to d1t8ca1

Details for d4j6pa_

PDB Entry: 4j6p (more details), 1.9 Å

PDB Description: Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form F)
PDB Compounds: (A:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4j6pa_:

Sequence, based on SEQRES records: (download)

>d4j6pa_ d.169.1.1 (A:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
swiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrklg
awvcdrlatctpp

Sequence, based on observed residues (ATOM records): (download)

>d4j6pa_ d.169.1.1 (A:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
swiglrnldlkgefiwvdgshvdysnwapgepgedcvmmrgsgrwndafcdrklgawvcd
rlatctpp

SCOPe Domain Coordinates for d4j6pa_:

Click to download the PDB-style file with coordinates for d4j6pa_.
(The format of our PDB-style files is described here.)

Timeline for d4j6pa_: