![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries) Uniprot P06734 156-298 |
![]() | Domain d4j6mg_: 4j6m G: [223587] automated match to d1t8ca1 complexed with so4 |
PDB Entry: 4j6m (more details), 2.48 Å
SCOPe Domain Sequences for d4j6mg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j6mg_ d.169.1.1 (G:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs wiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrklga wvcdrlatc
Timeline for d4j6mg_: