Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d4isva2: 4isv A:117-217 [223357] automated match to d1nj9a2 |
PDB Entry: 4isv (more details), 1.5 Å
SCOPe Domain Sequences for d4isva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4isva2 b.1.1.0 (A:117-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qpkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptke gnkfmassflhltsdqwrshnsftcqvthegdtvekslspa
Timeline for d4isva2: