Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Mannheimia haemolytica [TaxId:272629] [226568] (2 PDB entries) |
Domain d4iq1b2: 4iq1 B:81-209 [223299] Other proteins in same PDB: d4iq1a1, d4iq1a3, d4iq1b1, d4iq1b3, d4iq1c1, d4iq1c3 automated match to d2pmta1 complexed with cl, gol |
PDB Entry: 4iq1 (more details), 1.85 Å
SCOPe Domain Sequences for d4iq1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iq1b2 a.45.1.0 (B:81-209) automated matches {Mannheimia haemolytica [TaxId: 272629]} klfgsktardkakaarwlaffnsdvhksfvplfrlpsyaegnetltktirqqsaeqileq lafanahlenhiffgeeisvadaylyimlnwcrllgldfshlsqlsafmqrveadqgvdn vreqeglkg
Timeline for d4iq1b2: