Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (3 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (14 PDB entries) |
Domain d4iijd1: 4iij D:2-245 [223196] Other proteins in same PDB: d4iija2, d4iijb2, d4iijc2, d4iijd2, d4iije_ automated match to d1tubb1 complexed with ca, cl, gdp, gtp, mes, mg |
PDB Entry: 4iij (more details), 2.6 Å
SCOPe Domain Sequences for d4iijd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iijd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d4iijd1: