Lineage for d4iijd1 (4iij D:2-245)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592224Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592225Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1592226Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1592334Protein automated matches [226837] (3 species)
    not a true protein
  7. 1592335Species Cow (Bos taurus) [TaxId:9913] [226564] (14 PDB entries)
  8. 1592373Domain d4iijd1: 4iij D:2-245 [223196]
    Other proteins in same PDB: d4iija2, d4iijb2, d4iijc2, d4iijd2, d4iije_
    automated match to d1tubb1
    complexed with ca, cl, gdp, gtp, mes, mg

Details for d4iijd1

PDB Entry: 4iij (more details), 2.6 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-apo complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4iijd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iijd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d4iijd1:

Click to download the PDB-style file with coordinates for d4iijd1.
(The format of our PDB-style files is described here.)

Timeline for d4iijd1: