Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Photobacterium leiognathi [TaxId:553611] [49337] (9 PDB entries) |
Domain d1bzoa_: 1bzo A: [22292] complexed with cu, ium, zn |
PDB Entry: 1bzo (more details), 2.1 Å
SCOPe Domain Sequences for d1bzoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh aimihaggdnhsdmpkalggggarvacgviq
Timeline for d1bzoa_: