Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) |
Domain d4i50b1: 4i50 B:2-245 [222916] Other proteins in same PDB: d4i50a2, d4i50b2, d4i50c2, d4i50d2, d4i50e_, d4i50f1, d4i50f2, d4i50f3 automated match to d1tubb1 complexed with acp, ca, cl, ep, gdp, gol, gtp, mes, mg |
PDB Entry: 4i50 (more details), 2.3 Å
SCOPe Domain Sequences for d4i50b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i50b1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d4i50b1: