Lineage for d4i4tb2 (4i4t B:246-438)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657768Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1657875Protein automated matches [227071] (2 species)
    not a true protein
  7. 1657876Species Cow (Bos taurus) [TaxId:9913] [226565] (14 PDB entries)
  8. 1657882Domain d4i4tb2: 4i4t B:246-438 [222908]
    Other proteins in same PDB: d4i4ta1, d4i4tb1, d4i4tc1, d4i4td1, d4i4te_
    automated match to d1jffb2
    complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn

Details for d4i4tb2

PDB Entry: 4i4t (more details), 1.8 Å

PDB Description: crystal structure of tubulin-rb3-ttl-zampanolide complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4i4tb2:

Sequence, based on SEQRES records: (download)

>d4i4tb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d4i4tb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdsknmmaacdprhgryl
tvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfigns
taiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOPe Domain Coordinates for d4i4tb2:

Click to download the PDB-style file with coordinates for d4i4tb2.
(The format of our PDB-style files is described here.)

Timeline for d4i4tb2: