![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (42 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [194688] (5 PDB entries) |
![]() | Domain d4i42f_: 4i42 F: [222887] automated match to d4elwa_ complexed with 1ha, bct, btb, cl, edo, gol, peg, so4 |
PDB Entry: 4i42 (more details), 1.85 Å
SCOPe Domain Sequences for d4i42f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i42f_ c.14.1.0 (F:) automated matches {Escherichia coli [TaxId: 83333]} miypdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqal adaryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpk pvvamvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkka reiwflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadc dgqaglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
Timeline for d4i42f_: