Lineage for d1b4la_ (1b4l A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) 
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (8 PDB entries) 
Domain d1b4la_: 1b4l A: [22282]
Details for d1b4la_
PDB Entry: 1b4l (more details), 1.8 Å
PDB Description: 15 atmosphere oxygen yeast cu/zn superoxide dismutase room temperature (298k) structure
SCOP Domain Sequences for d1b4la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4la_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn
SCOP Domain Coordinates for d1b4la_:
Click to download the PDB-style file with coordinates for d1b4la_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b4la_:
- d1b4la_ first appeared (with stable ids) in SCOP 1.55
- d1b4la_ appears in SCOP 1.57
- d1b4la_ appears in SCOP 1.61
- d1b4la_ appears in the current release, SCOPe 2.08
View in 3D