Lineage for d4hz0b_ (4hz0 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580579Species Escherichia coli K-12 [TaxId:83333] [225819] (2 PDB entries)
  8. 2580583Domain d4hz0b_: 4hz0 B: [222803]
    automated match to d1kzna_
    complexed with 1av, mg

Details for d4hz0b_

PDB Entry: 4hz0 (more details), 2.2 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (B:) DNA topoisomerase 4 subunit B

SCOPe Domain Sequences for d4hz0b_:

Sequence, based on SEQRES records: (download)

>d4hz0b_ d.122.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrg
mpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnalskrvevnvrrd
gqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakav
lcpgveitfkdeinnteqrwcyq

Sequence, based on observed residues (ATOM records): (download)

>d4hz0b_ d.122.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrg
mpvdihpeegvpavelilcrlhaggkfsnknyqfsgglvgisvvnalskrvevnvrrdgq
vyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavlc
pgveitfkdeinnteqrwcyq

SCOPe Domain Coordinates for d4hz0b_:

Click to download the PDB-style file with coordinates for d4hz0b_.
(The format of our PDB-style files is described here.)

Timeline for d4hz0b_: