Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins) Pfam PF00491 |
Protein Arginase [52770] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [142346] (33 PDB entries) Uniprot P05089 5-313 |
Domain d4hxqa_: 4hxq A: [222779] automated match to d4hwwa_ complexed with mn, x8a |
PDB Entry: 4hxq (more details), 1.45 Å
SCOPe Domain Sequences for d4hxqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hxqa_ c.42.1.1 (A:) Arginase {Human (Homo sapiens) [TaxId: 9606]} srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf glaregnhkpidyl
Timeline for d4hxqa_: