Lineage for d4hlda_ (4hld A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480891Species Staphylococcus aureus [TaxId:282458] [193407] (9 PDB entries)
  8. 2480902Domain d4hlda_: 4hld A: [222658]
    automated match to d2ccka_
    complexed with 16t

Details for d4hlda_

PDB Entry: 4hld (more details), 2 Å

PDB Description: Sulfonylpiperidines as Novel, Antibacterial Inhibitors of Gram-Positive Thymidylate Kinase (TMK): Compound 11
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4hlda_:

Sequence, based on SEQRES records: (download)

>d4hlda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records): (download)

>d4hlda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriikndqedlkfhekviegyqeiihnesqrfksvnadqple
nvvedtyqtiikylek

SCOPe Domain Coordinates for d4hlda_:

Click to download the PDB-style file with coordinates for d4hlda_.
(The format of our PDB-style files is described here.)

Timeline for d4hlda_: