Lineage for d4hi7a1 (4hi7 A:3-87)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487355Species Drosophila mojavensis [TaxId:7230] [226515] (1 PDB entry)
  8. 2487356Domain d4hi7a1: 4hi7 A:3-87 [222618]
    Other proteins in same PDB: d4hi7a2, d4hi7a3, d4hi7b2
    automated match to d1r5aa2
    complexed with gsh

Details for d4hi7a1

PDB Entry: 4hi7 (more details), 1.25 Å

PDB Description: crystal structure of glutathione transferase homolog from drosophilia mojavensis, target efi-501819, with bound glutathione
PDB Compounds: (A:) gi20122

SCOPe Domain Sequences for d4hi7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hi7a1 c.47.1.0 (A:3-87) automated matches {Drosophila mojavensis [TaxId: 7230]}
kpilygidasppvravkltlaalqlpydykivnlmnkeqhseeylkknpqhtvplledgd
aniadshaimaylvskygkddslyp

SCOPe Domain Coordinates for d4hi7a1:

Click to download the PDB-style file with coordinates for d4hi7a1.
(The format of our PDB-style files is described here.)

Timeline for d4hi7a1: