SCOPe 2.07: Domain d4hhzb1: 4hhz B:1-135

Lineage for d4hhzb1 (4hhz B:1-135)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)

8. Domain d4hhzb1: 4hhz B:1-135 [222612]
   Other proteins in same PDB: d4hhza2, d4hhzb2, d4hhzc2, d4hhzd2
   automated match to d1gs0a1
   complexed with 15s, so4

Details for d4hhzb1

PDB Entry: 4hhz, 2.72 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhzb1:

Sequence; same for both SEQRES and ATOM records:

>d4hhzb1 a.41.1.0 (B:1-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

Timeline for d4hhzb1:

• d4hhzb1 first appeared in SCOPe 2.03
  
• d4hhzb1 appears in SCOPe 2.06
  
• d4hhzb1 appears in the current release, SCOPe 2.08