Lineage for d4gypb1 (4gyp B:4-137)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554490Protein D-glucarate dehydratase [54831] (2 species)
  7. 2554491Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)
  8. 2554493Domain d4gypb1: 4gyp B:4-137 [222276]
    Other proteins in same PDB: d4gypa2, d4gypb2, d4gypc1, d4gypc2, d4gypd1, d4gypd2
    automated match to d1ec7d2
    complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypb1

PDB Entry: 4gyp (more details), 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4gypb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gypb1 d.54.1.1 (B:4-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg

SCOPe Domain Coordinates for d4gypb1:

Click to download the PDB-style file with coordinates for d4gypb1.
(The format of our PDB-style files is described here.)

Timeline for d4gypb1: