Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries) |
Domain d4gv7d2: 4gv7 D:797-1010 [222203] Other proteins in same PDB: d4gv7a1, d4gv7b1, d4gv7c1, d4gv7d1 automated match to d1gs0a2 complexed with mew |
PDB Entry: 4gv7 (more details), 2.89 Å
SCOPe Domain Sequences for d4gv7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gv7d2 d.166.1.0 (D:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfk
Timeline for d4gv7d2: