SCOP 1.61: Domain d1sxcb_: 1sxc B:

Lineage for d1sxcb_ (1sxc B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)

8. Domain d1sxcb_: 1sxc B: [22220]

Details for d1sxcb_

PDB Entry: 1sxc, 1.9 Å

PDB Description: crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution

SCOP Domain Sequences for d1sxcb_:

Sequence; same for both SEQRES and ATOM records:

>d1sxcb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxcb_:

• d1sxcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxcb_ appears in SCOP 1.59
  
• d1sxcb_ appears in SCOP 1.63
  
• d1sxcb_ appears in the current release, SCOPe 2.08