SCOPe 2.07: Domain d4grmd2: 4grm D:118-245

Lineage for d4grmd2 (4grm D:118-245)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4grmd2: 4grm D:118-245 [222111]
   Other proteins in same PDB: d4grma1, d4grmb1, d4grmc1, d4grmd1
   automated match to d1ktke2

Details for d4grmd2

PDB Entry: 4grm, 2 Å

PDB Description: the crystal structure of the high affinity tcr a6

PDB Compounds: (D:) A6 beta chain

SCOPe Domain Sequences for d4grmd2:

Sequence; same for both SEQRES and ATOM records:

>d4grmd2 b.1.1.2 (D:118-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4grmd2:

• d4grmd2 first appeared in SCOPe 2.03
  
• d4grmd2 appears in SCOPe 2.06
  
• d4grmd2 appears in the current release, SCOPe 2.08