SCOPe 2.03: Domain d4gqra2: 4gqr A:404-496

Lineage for d4gqra2 (4gqr A:404-496)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (53 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d4gqra2: 4gqr A:404-496 [222093]
   Other proteins in same PDB: d4gqra1
   automated match to d1hnya1
   complexed with ca, cl, myc, nag

Details for d4gqra2

PDB Entry: 4gqr, 1.2 Å

PDB Description: human pancreatic alpha-amylase in complex with myricetin

PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d4gqra2:

Sequence; same for both SEQRES and ATOM records:

>d4gqra2 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d4gqra2:

• d4gqra2 is new in SCOPe 2.03-stable
  
• d4gqra2 appears in SCOPe 2.04
  
• d4gqra2 appears in the current release, SCOPe 2.08