![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) automatically mapped to Pfam PF01126 |
![]() | Protein Heme oxygenase HmuO [89159] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries) Uniprot P71119 |
![]() | Domain d4gpcb_: 4gpc B: [222074] automated match to d1v8xa_ complexed with asc, bla, so4 |
PDB Entry: 4gpc (more details), 1.85 Å
SCOPe Domain Sequences for d4gpcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gpcb_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]} taglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavr asgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpa lvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnle lsdeqrehllkeatdafvfnhqvfadlgkgl
Timeline for d4gpcb_: