Lineage for d4gk1e_ (4gk1 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608379Domain d4gk1e_: 4gk1 E: [221970]
    automated match to d2ox9b_
    complexed with gol, so4; mutant

Details for d4gk1e_

PDB Entry: 4gk1 (more details), 2.24 Å

PDB Description: crystal structure of cd23 lectin domain mutant d270a
PDB Compounds: (E:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4gk1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gk1e_ d.169.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwnaafcdr
klgawvcdrlatct

SCOPe Domain Coordinates for d4gk1e_:

Click to download the PDB-style file with coordinates for d4gk1e_.
(The format of our PDB-style files is described here.)

Timeline for d4gk1e_: