Lineage for d4ghhc2 (4ghh C:148-357)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549597Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2549732Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 2549746Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. 2549760Domain d4ghhc2: 4ghh C:148-357 [221912]
    automated match to d1q0oa2
    complexed with 4nc, ca, cl, fe2, p6g, peg, pg4

Details for d4ghhc2

PDB Entry: 4ghh (more details), 1.55 Å

PDB Description: Structure of Homoprotocatechuate 2,3-Dioxygenase from B.fuscum in complex with 4-Nitrocatechol at 1.55 Ang resolution
PDB Compounds: (C:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d4ghhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ghhc2 d.32.1.3 (C:148-357) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqask

SCOPe Domain Coordinates for d4ghhc2:

Click to download the PDB-style file with coordinates for d4ghhc2.
(The format of our PDB-style files is described here.)

Timeline for d4ghhc2: