SCOPe 2.07: Domain d4gera_: 4ger A:

Lineage for d4gera_ (4ger A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein automated matches [191194] (3 species)
   not a true protein

7. Species Paenibacillus polymyxa [TaxId:1406] [193740] (2 PDB entries)

8. Domain d4gera_: 4ger A: [221876]
   automated match to d4b52b_
   complexed with ca, lys, thr, zn

Details for d4gera_

PDB Entry: 4ger, 1.59 Å

PDB Description: Crystal structure of Gentlyase, the neutral metalloprotease of Paenibacillus polymyxa

PDB Compounds: (A:) Gentlyase metalloprotease

SCOPe Domain Sequences for d4gera_:

Sequence; same for both SEQRES and ATOM records:

>d4gera_ d.92.1.2 (A:) automated matches {Paenibacillus polymyxa [TaxId: 1406]}
atgtgkgvlgdtksftttasgssyqlkdttrgngvvtytasnrqsipgtiltdadnvwnd
pagvdahtyaaktydyykakfgrnsidgrglqlrstvhygsrynnafwngsqmtygdgdg
stfiafsgdpdvvghelthgvteytsnleyygesgalneafsdvigndiqrknwlvgddi
ytpniagdalrsmsnptlydqpdhysnlytgssdnggvhtnsgiinkayyllaqggtfhg
vtvngigrdaavqiyysaftnyltsssdfsnaraaviqaakdqygansaeataaaksfda
vgvn

Timeline for d4gera_:

• d4gera_ first appeared in SCOPe 2.03
  
• d4gera_ appears in SCOPe 2.06
  
• d4gera_ appears in the current release, SCOPe 2.08